PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10011820
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 256aa    MW: 28531.7 Da    PI: 4.8501
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10011820genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.4e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT++Ed+ll ++++ +G ++W++ ++  g+ R++k+c++rw +yl
      Lus10011820 14 RGPWTPQEDQLLTCYIQNHGHPNWRALPKLAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding50.54.7e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E+++++++++ lG++ W++Ia++++ gRt++++k+ w+++l
      Lus10011820  67 RGNFTRDEEDIIIRLHHSLGNR-WSAIAAELP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.9E-24564IPR009057Homeodomain-like
PROSITE profilePS5129415.629961IPR017930Myb domain
SuperFamilySSF466898.58E-2911108IPR009057Homeodomain-like
SMARTSM007176.0E-131363IPR001005SANT/Myb domain
PfamPF002496.9E-161461IPR001005SANT/Myb domain
CDDcd001672.09E-101661No hitNo description
PROSITE profilePS5129424.88162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.0E-2665117IPR009057Homeodomain-like
SMARTSM007172.4E-1466114IPR001005SANT/Myb domain
PfamPF002496.1E-1567112IPR001005SANT/Myb domain
CDDcd001674.51E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MVRAPCCEKK GLKRGPWTPQ EDQLLTCYIQ NHGHPNWRAL PKLAGLLRCG KSCRLRWINY  60
LNPNIKRGNF TRDEEDIIIR LHHSLGNRWS AIAAELPGRT DNEIKNVWHT HLKKRLNQNN  120
NQGKQQSAET QKQSYAPLSP DQLSFGTSTS SGAAVSSVTA DNSLATAETS NYVELPSPTS  180
LDDFPIIDDD LWSDPSQTEE WVNMQFDDTQ INFSDFWELS TVEGSTGGGV VPGIGDSVDF  240
WYDMLVQAGE IEGLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-26121162105MYB PROTO-ONCOGENE PROTEIN
1msf_C4e-26121162105C-Myb DNA-Binding Domain
1mse_C4e-26121162105C-Myb DNA-Binding Domain
1a5j_A4e-26121175109B-MYB
1h8a_C6e-261211625128MYB TRANSFORMING PROTEIN
1h89_C1e-25121164159MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-25121164159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8847961e-137HQ884796.1 Linum usitatissimum clone Contig612 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002311670.12e-83hypothetical protein POPTR_0008s16660g
TrEMBLB9HKG62e-83B9HKG6_POPTR; Uncharacterized protein
STRINGPOPTR_0008s16660.15e-83(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.11e-71myb domain protein 14